aa.comp {EnvNJ} | R Documentation |
Returns a table with the amino acid composition of the target protein.
aa.comp(target, uniprot = TRUE)
target |
a character string specifying the UniProt ID of the protein of interest or, alternatively, the sequence of that protein. |
uniprot |
logical, if TRUE the argument 'target' should be an ID. |
Returns a dataframe with the absolute frequency of each type of residue found in the target peptide.
aa.comp('MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQK', uniprot = FALSE)